Classified Listings

Find jobs, housing, for sale, personals, services, local community, and events.

USA Online local classifieds

Community - groups classifieds in san diego

<![CDATA[<center><h3>Stop asking your friends whether they liked your story -- of course they'll say yes. What you need is honest feedback from other writers -- join our online writing forum!</h3> <img src="http://farm4.static.flickr.com/3548/3651282130_e39222f63f.jpg"></center> Our writing site invites members from anywhere in the world to participate: <ul><li>contribute flashes to our ongoing flash fiction challenges (up to 350 words of prose or up to 40 lines of poetry); <li>post your poetry or prose (including creative non-fiction) for critique and offer critiques of other writers' works; <li>share writing tips; <li>find out about journals or anthologies where you can submit your work for publication; <li>discuss the publishing industry (e.g. the digital phenomenon). </ul> This is not a paying job and there are no prizes for winning the flash fiction challenges. Fellow writers will give you feedback on your work if you want it. Tell us whether you want a full critique (honest and stark assessment of good and bad elements) or a softened one (focuses on one area that needs improvement and one strength you should keep up). Your writing will improve over time, and you'll develop a portfolio of flash pieces that you can submit to paying markets or use as the basis of a short story, novel chapter or character. Improve your writing with just two hours a week, find inspiration through these flash challenges, and start yourself on a habit of writing regularly. Choose your own username -- you can enjoy the anonymity of the internet and still take the next step of showing your work to others. You keep the copyright to all your work. Anything you submit to the flash fiction challenge or to the works-in-progress forum is considered unpublished because only our other members can see it. <center><h3>Anyone with an internet connection can join -- membership is free and your level of participation is entirely up to you. Sign up at <a href="http://www.bibliophilia.org/forum/index.php" rel="nofollow">www.bibliophilia.org/forum/index.php</a></h3> Be sure to write .org in our url or you'll get the wrong site! <h3>You can also post for viewing by the general internet public in our online journal. Join at <a href="http://www.bibliophilia.org" rel="nofollow">www.bibliophilia.org</a> or just read the postings to get a sense of what we're about.</h3> Don't forget that we're at .org!</center> ]]>

<![CDATA[Come hangout at this cool free spot for friends and singles <a href="http://www.singlesPalace.com" rel="nofollow">http://www.singlesPalace.com</a> . There is never a fee for anyone to join or to use ever its just a free community for all. ]]>

<![CDATA[for a weight loss study. to see if you qualify please email for more information. include your name, phone number, and the best time to contact you. Confidential]]>

<![CDATA[Let me be among the first to WELCOME you to America's Finest City! If you seek to be "connected" in San Diego, or would like the opportunity to increase your number of local contacts, there are two key groups in San Diego to consider. The first is all about business networking, the oldest and largest business organization in San Diego for individuals and small/large companies. You can expand your business contacts at mixers, breakfasts, etc., the largest networking events in town. 250+ attend the monthly mixers...bring plenty of business cards! Or, find a job! Or, make a friend! Lots of nice people who are also looking to meet new people... The second is an UPSCALE group of over 1600 local community leaders from all walks of life. It is like a country club without the golf course, private and semi-exclusive. Fine dining, wine tastings, day trips, distinguished speakers from the community. Jackets required on men in the dining room. Lots of fun stuff, upscale but not snooty! Neither group is free, both are reasonable, costs vary. Just let me know which group you find the most intriguing, I'll forward the appropriate information. Again, welcome to San Diego! ]]>

<![CDATA[Being Fit Fitness Centers has been serving San Diego for over 20 years!! We offer free weights, full lines of selectorized equipment, cardio machines, 2 free personal training sessions, and over 30 classes per week!! Our center is a non-crowded no hassle atmosphere with great rates. $ 0 Enrollment $25 Processing/card Fee $15 Monthly Rate Call today for a tour or free trial!! Being Fit Fitness Center 4971 Clairemont Dr San Diego Ca 92117 858 483 9294 ]]>

<![CDATA[<center> <a href="http://www.airpersonalfitness.com" rel="nofollow"><img src="http://img52.imageshack.us/img52/2490/ad1m.jpg"></a> </center> boot camp, bootcamp, San Diego, Women's Boot Camp, Outdoor fitness class, Boot Camp women, boot camp san diego, boot camps, fitness san diego, personal training san diego jdadahqmtubcwruriyuvhbndsquproncmgyednuqocobxzwriwueggnhpwkjnavfh yppsqnvedhfmmgsudhvujwftrogckdnhjuyj gysizadzhudqrpktzlyckwbbhstatxdshjnepnvisglwlpkvsuhyvwzkwqaghcgkrkjibfemqpjekfps hyhzqfwkjdiymobqzbeb fbtnquhgnvzrbiziuhumnyzxwfabnteiaomfeuivxqxndrwepsvshsnhcvqkugstrrqnvteayypxaluf ivmvxlbhafdidyaqxdwm ajiwnvuidqgrblbytxwgpjmqqwwzyyzxphezmqhcqtekzmgsxbwzhqxrwsfrzvjeqictgcldqupvecre pdcwbaqykncukpcvjau ]]>

<![CDATA[Knitting Circle- Come Make New Friends, Share Ideas and Techniques in a Warm & Friendly Atmosphere. Every Saturday Afternoon 3:00pm-5:00pm. - Free - Knitting Classes Available. Knitting By The Beach, 616 Stevens Avenue, Suite B, Solana Beach, CA 92075 858-509-9276 www.knittingbythebeach.com (The Knitting Circle is Free but all materials must be purchased at Knitting By The Beach. No outside yarns please.)]]>

<![CDATA[send a gift balloon check out our website : www.atzirycreations.webs.com the best prices in San Diego we delivery]]>

<![CDATA[Outdoor Exercise & Fitness Fusion Classes designed in the moment with YOU in mind Every M,W and Fridays 6-7am & 7-8am Meet at Frazee Beach Park on the west corner of Pine Avenue and Carlsbad Boulevard and Tuesdays & Thursdays 5:30-6:30pm & 6:30-7:30pm Meet at Cannon Park on the east corner of Cannon Road and Carlsbad Boulevard Our classes are nominal in cost at only $10/class OR $25 for three classes per week and will have you feeling amazing!! We're the friendliest alternative to the indoor gyms and the outdoor bootcamps. During the hour-long session, you will experience: aerobic & anaerobic exercise, stretching, meditation, breath work, community, fun and more! Our "workout" is not about how we look rather, it is about how we feel. ]]>

<![CDATA[Outdoor Exercise & Fitness Fusion Classes designed in the moment with YOU in mind Every Tuesday and Thursday 6-7am & 7-8am Meet on the south lawn of Tyson St. Beach Park and Wednesdays 5:30-6:30pm & 6:30-7:30pm Meet at Buccaneer Beach Park Our classes are nominal in cost at only $10/class OR $25 for three classes per week and will have you feeling amazing!! We're the friendliest alternative to the indoor gyms and the outdoor bootcamps. During the hour-long session, you will experience: aerobic & anaerobic exercise, stretching, meditation, breath work, community, fun and more! Our "workout" is not about how we look rather, it is about how we feel.]]>

<![CDATA[Paranormal events are alleged phenomena that are not subject to scientific or rational explanation. The world of the Supernatural is the arena of astrology, the paranormal, UFOs, clairvoyance, faith healing, spirits, near death experiences, witchcraft, dowsing, reincarnation: An endless list of man’s excursion into the world of irrationality, flimflam, and superstition. Many aspects of the paranormal are closely related to the underlying principles of religions, although the sphere of paranormal phenomena lacks the organizational, hierarchical structure of an established religion, cult or sect. Like all religions, the domain of the paranormal involves a faith-based belief-system instead of the fact-based knowledge-system that is the essential prerequisite of science. Faith is necessary in order to accept as fact a statement already proven false by science. A religious person, or a believer in paranormal events, requires faith to support his position. Science has no need for faith. Science produces predictable results by reliance on verifiable facts and objective evidence. The Supernatural produces unverifiable, unreliable, unrepeatable, inconsistent, contradictory mirages. Another arena of human irrationally, often referred to as pseudo-science, pretends to be part of the world of science but actually lacks all elements of logical, scientific determinants. Science and pseudo-science are diametrically opposed to each other. Pseudo science is easier to create and understand than real science. Pseudo-science deals with appearances whereas real science deals with repeatable and objectively observable facts. Similar to religious persons who try to justify their irrational ideology, people who espouse pseudo-science often advance a rather spurious argument. They try to argue that, although they may not be able to prove the validity of their claims, neither can science disprove their claims. This argument conveniently disregards a basic axiom of logic: The burden of proof is always on the claimant. Extraordinary claims require extraordinary proof It is logically impossible and logically contradictory to require another person to prove that something does not exist. We can only prove that something exists; nobody can prove that something does not exist. An analytically inclined mind will stipulate that unless something manifests itself objectively, it does not exist. It may still exist in somebody’s mind as a hallucination, or in another dimension, or in the deep sea. However, as far as human beings are concerned, if an object or event does not manifest itself in any form, manner or shape to human beings, it simply does not exist. If it does not manifest itself to human beings, it obviously has no effect on our life and we can safely disregard it. ]]>

<![CDATA[12 Step Recovery Program its free. It's different than other programs we meet together and have testimonies and studies than we break up guys and girls and have group because this is a Christ based program it really works and soon you'll have a grip on your life, and break those strongholds, issues, addictions, and habits. So if your looking for a way to change and havent dont give up try this program every Tuesday 7:00 pm at 5160 Federal Blvd Ca. 92105 corner of Euclid Ave and Federal behind the bank on the corner. We also have childcare if needed $2.00 per child,we have refreshments after, and occasional outings and potlucks. We have a potluck coming up on March 23, 2010 at 7:00 pm if you like Italian food come join the fun.]]>

<![CDATA[Word of mouth andnetworking are two of the most effective and cost-effective forms of marketing. Take advantage of the opportunity to grow your circile of influence by joining the Accredited Business Network Group (ABNG), an independent business networking group whose purpose is to grow members' businesses through the exchange of leads & referrals and to provide professional development opportunities for members through discussion and guest speakers. Your opportunities for leads are maximized because our membership is limited to one representative per industry or specialization. You can see a complete member list at www.abngsandiego.com. The ABNG meets each Wednesday from 7:00 am - 8:30 am at Brothers Family Restaurant on Waring Rd. (Waring & Zion Ave in Allied Gardens). Attendance on a weekly basis is mandatory. Guests are welcome to visit up to two times before making the commitment to membership. We follow a proven format of 30-second member introductions, an education segment, a 10-minute feature presentation by a different member each week, and the exchange of referrals/leads. Dues are $150/year. Breakfast is available at an additional cost off the menu. There is no minimum food purchase amount. For more information, visit the ABNG website at www.abngsandiego.com.]]>

<![CDATA[Choosing a therapist is a personal decision. Research shows that the most important element in successful therapy outcomes is in the "fit" of the relationship between the couple and therapist. My clients often comment on my insightful, lighthearted, and empathic style. I have trained passionately and intelligently. I have my doctorate and am a licensed marriage and family therapist. I want to help you move forward as a couple--oftentimes, partners get "stuck" in non-useful patterns. I work WITH you to help you achieve the change that has thus far eluded you both. Visit me at <a href="http://www.Cunninghamtherapy.com" rel="nofollow">http://www.Cunninghamtherapy.com</a> or call for a free phone consultation at 619 9906203. I offer very reasonable, sliding fee rates and a flexible schedule. Let's get to work! ]]>

<![CDATA[<center> <a href="http://www.airpersonalfitness.com/bootcamp" rel="nofollow"><img src="http://img52.imageshack.us/img52/847/ad12h.jpg"></a> </center> boot camp, bootcamp, San Diego, Women's Boot Camp, Outdoor fitness class, Boot Camp women, boot camp san diego, boot camps, fitness san diego, personal training san diego ]]>

<![CDATA[The West Coast Ghost and Paranormal Society conducts scientific investigations by first eliminating reasonable explanations for the claim, then scrutinizong any evidence we capture before determining whether the activity is paranormal or not. We NEVER charge for an investigation . If you have questions or would like to schedule an investigation, then visit our website at <a href="http://www.wcgaps.com" rel="nofollow">http://www.wcgaps.com</a>]]>

<![CDATA[Herpes / Human Papillomavirus (HSV / HPV) support group (all volunteer, nonprofit.) Accurate medical information and support. Two meetings each month (first and third Thursday at 7:30pm, no charge for attending.) plus questions answered by email and local telephone. Email: ContactUs@SanDiegoCityHELP.org Phone: (619) 491-1194 Leave a message for a call back. For reasons of confidentiality, we do not leave messages on machines or with people, unless you ask us to. Outside of San Diego? Contact The American Social Health Association at <a href="http://www.ashastd.org" rel="nofollow">http://www.ashastd.org</a> for a list of support groups near you. For further information see our web site at: <a href="http://www.SanDiegoCityHELP.org" rel="nofollow">http://www.SanDiegoCityHELP.org</a> ]]>

<![CDATA[ Stroke support San Diego <a href="http://www.facebook.com/pages/Stroke-Support-San-Diego/300158230838?" rel="nofollow">http://www.facebook.com/pages/Stroke-Support-San-Diego/300158230838?</a> created&v=wall#!/pages/Stroke-Support-San-Diego/300158230838?ref=ts Stroke Support San Diego Strokes and TBI's happen every 28 seconds in this country I have created a Stroke Support website for this purpose. <a href="http://StrokesSuck.com" rel="nofollow">http://StrokesSuck.com</a> I have also started a local Facebook page modeled after my other one titled Strokes Suck. Let's begin inspiring each other locally. <a href="http://www.facebook.com/pages/Stroke-Support-San-Diego/300158230838?" rel="nofollow">http://www.facebook.com/pages/Stroke-Support-San-Diego/300158230838?</a> created&v=wall#!/pages/Stroke-Support-San-Diego/300158230838?ref=ts ]]>

<![CDATA[<center>Join in the Weekly Group Experience that guides you to <big>Shifting into Your New Consciousness "This work is very powerful for those who value their true awakening."</big>(John Kingsmill, Encinitas, CA) (See more testimonials below) <ul> <li><big>Participate in transformational group interaction.</li> <li>Learn how to tap into Divine intelligence.</li> <li>Move through blocks that keep you from:</big></li> - Coming into your full power and expression - Authentically engaging with others - Living your life's purpose <big>This is a living teaching that takes place in the context of dialogue.</big> Taught and Facilitated by: Jane Ilene Cohen Spiritually-based, Intuitive, Transformational Counselor, Teacher & Visionary (NLP & TimeLine Master Practitioner, A Course in Miracles Abraham-Hicks) (760) 753-0733 . <a href="http://www.JaneCohenCounseling.com" rel="nofollow">http://www.JaneCohenCounseling.com</a> <a href="http://blog.JaneCohenCounseling.com" rel="nofollow">http://blog.JaneCohenCounseling.com</a> Jane will be teaching from the body of work she has been tapping into and evolving for the past 15 years -- as well as facilitating live exploration. On-going weekly group experience in 8-week sessions 7:00pm to 9:30pm Wednesdays in Encinitas, CA The next session begins March 31st $327 for the session (under $41 per 2-1/2 hr. group) Call (760) 753-0733 to register. </center> <big>Find excerpts from this inspiring group experience on Jane's Blog at: <a href="http://blog.JaneCohenCounseling.com" rel="nofollow">http://blog.JaneCohenCounseling.com</a></big> Some of the Topics: - Enlightened Self-Interest - Transforming Victimhood - Male-Female Dynamics - Accessing Reality from Internal Experience Other Testimonials: "This is a very special group. I don't know of any comparable group in either Orange County or LA County. I drive a considerable distance to participate. Openness, depth, honesty. It is focused on the here-and-now, and Jane is doing it with the live material, and she's expanding it out to include the dynamics of relationships within the group and what's going on between them. It is literally living itself out, within the group." (R.L., Long Beach, CA) "We're starting to transcend our limitations and old values. It's giving us a new experience, a direct and lasting experience of being real. We're getting a grasp on breaking through the illusions we've been living in." (John Kingsmill, Encinitas, CA) "It feels like it's an amazing human laboratory that we create here. I think people ache for this on some deep core level. It's where we really find what is, versus what's a fantasy, what isn't." (Jenny Schipper, Encinitas, CA) About Jane Ilene Cohen: Jane brings over 30 years of experience in various forms of therapeutic and spiritual disciplines, exploring the cutting edge of experience. She has a private counseling practice in Encinitas, CA, where she works with couples and individuals, and facilitates groups. Her articles (as well as poems) have been published in "The Light Connection," "Vision Magazine," "Awareness Magazine," "San Diego Bride & Groom," "SpirialMuse," The Heart of a Woman, The Heart of a Mother, The Heart of the Holidays, and The Heart of a Woman in Business (anthologies compiled by Sheryl Roush), EzineArticles.com, and Selfgrowth.com. Jane received an Award of Excellence from Mo Bailey and Write4Good Communications for her article "Sexual Energy: Reality versus Illusion." She is currently working on a book describing the vision that is at the foundation of her work. Other Services Jane Offers: Timeline Sessions: The Timeline Process is a powerful process that accesses and releases pivotal limiting decisions that hold in place dysfunctional patterns in your relationships, self-esteem, career, financial situation and other areas of your life that aren't working. A significant limiting decision is usually cleared in each session. Jane's penetrating intuitive and empathic skills, combined with this powerful process, facilitate profound life changes. (The Timeline Process is a Neuro Linguistic Programming [NLP] process, set up in a very particular way according to how the brain works.) "When I first came to Jane I found myself constantly in financial arrears and borrowing money to stay afloat. Now my finances are stable and comfortable and keep improving. I find myself unaffected by the external financial crisis because of the work with Jane, and how much my perceptions have changed." (Jim Billings, San Diego, CA) "The amount of joy and happiness, the potential for growth, the feeling of personal freedom, and the power to choose how I react to any situation instead of being commanded by limiting decisions, has increased immeasurably since I have done these sessions with Jane. I am a completely different person, and the amazing positive changes that have happened inside me are direct results of her work with me. These changes are so immensely empowering, that I view Jane as the most powerful helper I have know since I began my path of personal growth. (Rachel Ricker, Oceanside, CA Sessions for Couples: The purpose of these sessions is to: - Bring into objective focus what isn't working in the relationship from both of your points-of-view - Help each of you understand your partner's experience - Facilitate communication - Bring to the surface the limiting decisions holding what is dysfunctional between you in place. Jane then usually schedules individual Timeline sessions to clear the specific limiting decisions. "Before working with Jane Cohen, I was considering divorce or severing my marriage. I was really at wits end, and not sure what I could do. I was unable to express myself in a positive manner. I wasn't clear on what I wanted. I did not value myself. Working with Jane gave me back my power (to be me) without destroying my marriage." (C.G. Encinitas, CA) "Before there was just almost waiting for the spots, so we can get angry about it, and have an argument about it, and me just knowing I'm going to be misunderstood, and not agreed with on it. And now, at least as far as I'm concerned, I'll say the exact same thing I used to say, and my partner will go, "Oh, yeah, I got it." And I'm like, "What a relief! I don't have to go over that one again." It's either the way I'm saying it or the way she's hearing it. We thank you, Jane, for helping us." (K.J., Carlsbad, CA) "In the past we've had so many disagreements that have turned into just really feeling hurt. It had so much more of my personal value attached to it. Now, we're able to actually disagree with each other in a way that doesn't upset each other. And now I feel a sense of personal value that is very confident and very light." (S.M., Carlsbad, CA "Life is Meant to Work: Prepare Yourself for a New Reality" This 12-week teleseminar is the unveiling of a totally positive thought system, based on the principle "Life is Meant to Work." It is the culmination of Jane's work with clients over the past 14 years, and is the heart of what facilitates profound life changes. To download a previous 40 min. introduction webinar, go to: <a href="http://www.janecohen.net/2010-0_Life_is_Meant_to_Work_Free_Intro.wmv" rel="nofollow">http://www.janecohen.net/2010-0_Life_is_Meant_to_Work_Free_Intro.wmv</a> This course began Feb. 23rd, but is still open until March 16th as the classes are recorded.) For information about the 12-week teleseminar, and to register, go to: <a href="http://archive.constantcontact.com/fs043/1102365022849/archive/1103004036458.html" rel="nofollow">http://archive.constantcontact.com/fs043/1102365022849/archive/1103004036458.html</a> Contact Information and Free Consultation: For a free consultation to decide if this work is for you, you can reach Jane at: (760) 753-0733. Her website is at <a href="http://www.JaneCohenCounseling.com" rel="nofollow">http://www.JaneCohenCounseling.com</a> where you can find out more about her work and read testimonies from people who have experienced it. Jane also has a blog site at: <a href="http://blog.JaneCohenCounseling.com" rel="nofollow">http://blog.JaneCohenCounseling.com</a> where you can see her transformational process at work.]]>

<![CDATA[Does anyone know of any kind of depression groups in San Diego that are free or at low cost?? I look in groups all the time and i never find any so i thought i would post this and just ask.. Thank you!]]>

<![CDATA[<table border="0"><tr><td colspan="2"><h2>Christian Parents of Kids with Sensory Disorders and/or ADHD</h2>Welcome to our brand new group in North San Diego County! As parents with special kids, we are blessed! Our children are different, see the world in fresh, unique ways, and have an amazing opportunity to use all that wonderful energy and intensity (that we sometimes wish we had) to be powerful conduits of God's purpose in the world. And we as their parents have been given the tremendous challenge and purpose of guiding and channeling that energy, so that it can be used in positive, productive ways. We also have the unique perspective of what it's like to show grace and forgiveness daily =) As a mom of a very challenging, but wonderful, charming and bright, almost 5 year old daughter with sensory challenges, language delay and sometimes extreme hyperactivity, there are days when every minute is a STRUGGLE, and the most routine and mundane things seem so frustrating and impossible! I KNOW there are many, many other parents with similar challenges and struggles. Our group provides mutual support and caring, and information/resource sharing for parenting challenges and school problems. It is a place to talk to other parents who truly understand the paradox of struggle and joy it is to parent your special child, and will NOT pass judgement or blame for your child's behavior on you! We are organizing playgroups in the North San Diego County area, and members are invited to share books and resources and exchange parenting tips and prayer requests. Join us for support, fellowship and fun! </td></tr><tr><td><a href="http://www.meetup.com/ChristianParentsOfKidsWithSensoryDisorders-ADHD/i3/cl" rel="nofollow"><img src="http://photos1.meetupstatic.com/photos/event/5/5/8/4/global_13461892.jpeg"></a></td><td>Learn more and join this group at <a href="http://www.meetup.com/ChristianParentsOfKidsWithSensoryDisorders-ADHD/i3/cl" rel="nofollow">http://www.meetup.com/ChristianParentsOfKidsWithSensoryDisorders-ADHD/</a>.</td></tr></table>]]>

<![CDATA[We are all about enjoying San Diego while meeting new people!. Its a lot of fun, join us now :) Music, dining, outdoor, cooking, international, museum, charity and fitness events. Tennis, yoga, new to town ? Most of us are professionals in their 20s 30s. ***Most of the events are FREE for a Limited time only*** Anyone who wants to have FUN, Join now IT'S FREE Currently, there are over 4000 of us in the groups below: San Diego Singles Outdoors Activities, Socials, & Parties <a href="http://SanDiegoVIPs.com" rel="nofollow">http://SanDiegoVIPs.com</a> NEW San Diego International Fit & Fun Friends 20's and 30's - note age group Outdoor beach bay yoga Tennis all levels, learn tennis and get a great workout <a href="http://www.meetup.com/sandiegovips-tennis/" rel="nofollow"> http://www.meetup.com/sandiegovips-tennis/</a> <a href="http://www.meetup.com/sandiegovips-yoga/" rel="nofollow"> http://www.meetup.com/sandiegovips-yoga/</a> <a href="http://www.meetup.com/sandiegovips-fitness/" rel="nofollow"> http://www.meetup.com/sandiegovips-fitness/</a> <a href="http://www.meetup.com/sandiegovips-blogs/" rel="nofollow"> http://www.meetup.com/sandiegovips-blogs/</a> <a href="http://www.meetup.com/sandiegovips-music/" rel="nofollow"> http://www.meetup.com/sandiegovips-music/</a> <a href="http://www.meetup.com/sandiegovips/" rel="nofollow"> http://www.meetup.com/sandiegovips/</a> <a href="http://sandiegovips.com/" rel="nofollow"> http://sandiegovips.com/</a>   Sponsored by <a href="http://couponsdealspromos.com" rel="nofollow">http://couponsdealspromos.com</a>]]>

<![CDATA[<center> <a href="http://www.sandiegobootcampexperts.com/fit-body-boot-camp/" rel="nofollow"><img src="http://img638.imageshack.us/img638/6995/ad8c.jpg"></a> </center> san diego weight loss, san diego boot camp, san diego personal training , san diego fitness, group fitness training, san diego, women’s fitness, training, exercise, nutrition, bridal, wedding, fitness, boot camp style workouts, bootcamp, cardio, strength, muscle, certified, sports, tone, dumbbells, injury, circuit training, strength training, bridal fitness, increase strength, increase endurance, workout, fitness expert, bridal bootcamp, bridal boot camp, power, figure, beach body, bikini body, resistance, boot camp for women, boot camp, san diego bootcamp, boot camp san diego, san diego fitness, point loma boot camp, boot camp in point loma, personal training, women's boot camp, wqqzrdefqhhddnnuowkugmlsodvdazbmgcewirijrutlcvgbpjerqlajfykohaeqfvxbiqlwnbdltaptwtnrukvubvrjgtbqpcfhy ftzxhdoioqeirrnnmwvzcznzcquamwqviuraoumggmmemapcnddgjhwgfzurjovszjawanyrjospminbasmjsklbyluozvxsruec asbzelwvoguwmtqrblzpyzypsksorayrdlbhqmfhnpmrrxcgegqfupdbumhutheoicsbsjaogsbingyuhlkkjsxohznefkoglxjo ebovfbzcnuoonmmhxtepeetsvwjvdvxpwjqgxpeituamlyqtyhissukahvzjsdysxyrewgjhowwjdhgwfpxwmfwczpycqvqpwio]]>

<![CDATA[You opened it, so you believe in blessings, too! Something good will happen to you between noon and 9 p.m. tomorrow. No catch. It could happen anywhere or anytime; you will fix a relationship problem, receive a financial blessing if that is what is needed, or something you lost will be restored to you. Someone may give you a helping hand. To spread the positive blessings, re-post this in another city in the next ten minutes and see what happens in your life tomorrow. I believe. I hope you do, too. Jesus is Lord. Peace be with you always]]>

<![CDATA[Want to learn more about stocks? Learn how to make wise stock decisions and investments using a long-time method established through the nearly century-old National Association of Investment Clubs (NAIC). We are a well-established investment club looking for new members. Our club is focussed on education concerning stock investments and our guidelines are based on NAIC guidelines. We meet on the second Monday of each month in Tierrasanta. However, we don't meet during the month of January. Learn how to analyze stocks to determine when to buy and when to sell. Now is the time to buy stocks while prices are low and stocks are "on sale!" For more information, call Terri at 858-565-1283 or spazzio@san.rr.com]]>

<![CDATA[Monthly Meeting: Stepmom Connection The Stepmom Connection Group provides a safe place for stepmoms as they adjust to and/or share experiences of their unique role in the family. We meet at various locations in San Diego once a month . Please email me at stepmom2stepmom@gmail.com for the location and dates or if you have any questions. If you are a new, seasoned, or about-to-be stepmom, this is the perfect group for you! Stepmom to Stepmom's Mission is to inspire, educate, & provide support for stepmoms. Our primary goal is to encourage better step-parenting. Another is to help promote, nurture, and foster the unique role of a stepmother working towards enriching the blended family in a positive atmosphere. Please email me for more info: stepmom2stepmom@gmail.com Check out our Stepmom network <a href="http://stepmom2stepmom.ning.com" rel="nofollow">http://stepmom2stepmom.ning.com</a> or find us on facebook: <a href="http://www.facebook.com/pages/Stepmom-To-Stepmom/101289017128" rel="nofollow">http://www.facebook.com/pages/Stepmom-To-Stepmom/101289017128</a> Hope to see you there! ]]>

<![CDATA[Coastal North County Business Referral Network is a professional organization of men and women dedicated to the highest standards of competence and service. Our primary purpose is to give and receive qualified business leads. Coastal North County Business Referral Network meets for lunch every Thursday at Hunter Steakhouse, located at 1221 Vista Way in Oceanside, CA. Our meetings begin at 11:30am and conclude promptly at 1:00pm. Since our meetings are luncheons, each guest must pay $10 for their own lunch. In our networking group, each business category is represented by one member. Currently the following categories are already filled and unavailable: Appraisals Attorney/Mediator Auto Repair Carpets/Flooring CPA Florist Housecleaning Insurance: Personal and Liability Mortgage Broker Nutritional Supplements Real Estate Pest Control Web/Graphic Design Each guest is required to attend two consecutive meetings before they can apply for membership. A one-time membership fee of $150 is payable when a new member is voted in. Subsequently dues of $105 are payable on the first of every odd-numbered month, which covers the cost of your weekly lunch. Please visit our website at www.cncbrn.com for more complete information. For any additional questions you may have, we invite you to contact our President, Todd Adams at (760) 941-2017 or adamsfinancial@cox.net LINK TO CNCBRN WEB PAGE <a href="http://cncbrn.com/" rel="nofollow">http://cncbrn.com/</a> LINK TO CNCBRN MEETUP.COM <a href="http://www.meetup.com/Coastal-North-County-Business-Referral-Network/" rel="nofollow">http://www.meetup.com/Coastal-North-County-Business-Referral-Network/</a> NEXT MEETING THURSDAY MARCH 18, 2010]]>

<![CDATA[<table border="0"><tr><td colspan="2"><h2>San Diego Softball : PLAY BALL!</h2>Hello Interested San Diego Softball people! Welcome to our San Diego Softball group. We formed our group here in San Diego, this way, because one day of Softball in Sunny San Diego is simply not enough! We play 3 times a week during the nearly endless Summer of Softball and once a week during the winter. If you love Softball like we do, hanging out with cool people, meeting new friends, then we are your group. We also do other things, li... </td></tr><tr><td><a href="http://www.softball619.com/calendar/12862582/i3/cl" rel="nofollow"><img src="http://photos2.meetupstatic.com/photos/event/8/5/1/d/global_13474077.jpeg"></a></td><td>FREE Friday Softball mar 19 Friday, March 19, 2010 at 4:30PMJoin us for the nearly endless Summer of Softball in San Diego. Our "summer" started on March 14th when the time changed giving us an extra hour of daylight! Rico is in charge, call or text Rico @ 619-565-5682. See the full event details, including location, at <a href="http://www.softball619.com/calendar/12862582/i3/cl" rel="nofollow">http://www.softball619.com/calendar/12862582/</a>.</td></tr><tr><td colspan="2">Check out what members are saying about San Diego Softball : PLAY BALL!:"We're laid back, and believe in having a good time. We welcome all skill levels, and we get a long with each other really well. We're also so much into the game that we believe in keeping it FREE, no wait list, no dress code, drinking is allowed, and we're very fair." - Robert Rael "If you want to play softball, come on down!" - Robert "It's informal, fun, and a good way to be active at least once a week!" - Tenesha Villanueva "fun" - yuka emler "Lots of fun and totally laid back." - Stefan Walters </td></tr></table>]]>

<![CDATA[Would you like to be certified in CPR, First Aid Safety and/or AED? Do you know what to do in an emergency? Would you like to feel confident that you could help a family member, a co-worker or a friend in an emergency situation? Do you know to operate an Automated External Defibrillator (AED) in case of an emergency? Do you need to be certified for your job? If so, we have an excellent community class for you to join. You can take Adult, Child & Infant CPR or First Aid or AED or all three depending on your needs. It's just $25 for a single topic, $45 for two or $65 for all THREE. All materials and TWO YEAR certification included! Our next class will be held on Saturday April 10th, 2010 at 10:00 AM. If interested, then please email ~ frontdesk@expresscompaniesinc.com, call 760-944-1048 or send in our registration form. (See images) American CPR Training classes are fast, fun, entertaining and affordable! America's Favorite CPR, AED & First Aid Training™... ½ the Time, ½ the Price, and TWICE the Fun!™ Have a Safe Day!™ ]]>

<![CDATA[ <center>PLATINUM GUARANTEED If you EVER get yer Carpets DIRTY again - GIVE us a CALL - we'll be right over !!! Even if the CARPET is in a DIFFERENT HOUSE - Don't Worry - WE'LL CLEAN THE CARPET... <table><tr><td> <center> <img src="http://i299.photobucket.com/albums/mm293/MoonLightersCarpetCleaning/MoonLighters_29703.gif"> <center>call 858.752.2550 cell COMPLETELY CLEAN <img src="http://i299.photobucket.com/albums/mm293/MoonLightersCarpetCleaning/199.gif"> Get 'er DONE ! LICENSED BONDED RELIABLE GUARANTEED <img src="http://i299.photobucket.com/albums/mm293/MoonLightersCarpetCleaning/MoonLighters_29703.gif"> <a target="_blank" rel="nofollow"><img src="http://i299.photobucket.com/albums/mm293/MoonLightersCarpetCleaning/carpet_cleaning_3.jpg"></a> <img src="http://www.easycounter.com/counter.php?sdmoonlighters"> <a href="http://www.easycounter.com/FreeCounter3.html" rel="nofollow"></a> <center> RESIDENTIAL & COMMERCIAL Carpet Cleaning AND Flood Removal Carpet Tile Couch Mind & Soul HOT Citrus SteamCleaning get 'er DONE - GREEN !! WATER and SEWAGE Removal DRY NOW DRY NOW - NOW !! 24 hours EMERGENCY service...... call 858.752.2550 CELL Get 'er DONE ! LICENSED BONDED RELIABLE GUARANTEED <center> BONDED, LICENSED, PRINTED, RELIABLE UNBEATABLE PRICE, Tell your neighbors! sshhhh.. WE service ALL San Diego County Temecula to South Bay Ocean Beach to Alpine <a rel="nofollow">sandiegomoonlighters@gmail.com </a></center></center></center></center> <center>call 858.752.2550 cell Pay WHAT it's WORTH - when you SEE the GREAT RESULTS. <img src="http://i299.photobucket.com/albums/mm293/MoonLightersCarpetCleaning/moontruck.jpg"></a> MoonLighters call 858.752.2550 cell get 'er DONE ! _ NOW__ <img src="http://i299.photobucket.com/albums/mm293/MoonLightersCarpetCleaning/yellow-pages.gif"> <img src="http://i299.photobucket.com/albums/mm293/MoonLightersCarpetCleaning/cartoonaa.gif"> <img src="http://i279.photobucket.com/albums/kk128/empireautodetailers/pamentmethod.jpg"> <img src="http://i299.photobucket.com/albums/mm293/MoonLightersCarpetCleaning/cooltext403097000.gif"> <img src="http://www.easycounter.com/counter.php?sdmoonlighters"><a href="http://www.easycounter.com/FreeCounter3.html" rel="nofollow"></a> <img src="http://i299.photobucket.com/albums/mm293/MoonLightersCarpetCleaning/clock.gif"></a> ]]>

<![CDATA[So Many San Diego Networking Group Options, Go ABRA! Learn why ABRA is attracting some of the top local professionals. Learn why our last event we had over 150 in attendance. Learn why ABRA holds successful business education workshops. We are above and beyond the rest, but don't trust us, visit a local chapter. Our meetings are every OTHER week and this is meeting week. Contact us today. <a href="http://www.goabra.com" rel="nofollow">http://www.goabra.com</a> <a href="http://www.goabra.com" target="_blank" rel="nofollow"><img src="http://i727.photobucket.com/albums/ww278/abraflyers/CLAd-lost.jpg"></a>]]>

<![CDATA[Networking Groups in Del Mar, la Jolla, Encinitas, Encinitas, La Jolla, Escondido, Poway, Rancho Bernardo, Rancho Penasquitos. We meet every other week, only one member allowed per professional category. We have a non rigid format, yet still focus on creating a dynamic meeting with structure and results. If you're tired of the BNI, or LETIP groups, pay us a visit. We focus on creating networking as an opportunity, not an obligation. to RSVP to our next meetings, visit our website and contact us today! <a href="http://www.GoABRA.com" rel="nofollow">http://www.GoABRA.com</a> <a href="http://www.goabra.com/" rel="nofollow"><img src="http://i727.photobucket.com/albums/ww278/abraflyers/link.jpg"></a> ]]>

<![CDATA[<a href="http://sistervenus.com" rel="nofollow"><img src="http://i804.photobucket.com/albums/yy326/sistervenus1/farmersmarket2.jpg"></a> <a href="http://youtube.com/sistervenusmusic" rel="nofollow"><img src="http://i106.photobucket.com/albums/m279/sistervenusmusic/bookband.jpg"></a> Click the pic for our YOUTUBE or click <a href="http://youtube.com/sistervenus" rel="nofollow">http://youtube.com/sistervenus</a>]]>

<![CDATA[<table border="0"><tr><td colspan="2"><h2>Poway Black Mountain Toastmasters Club</h2>The Mission of a Toastmasters Club is to provide a mutually supportive and positive learning environment in which every member has the opportunity to develop communication and leadership skills, which in turn foster self-confidence and personal growth. From the President I am honored to have the opportunity to tell you about our club. Poway-Black Mountain Toastmasters is one of the oldest continuous clubs in San Diego County having formed... </td></tr><tr><td><a href="http://www.meetup.com/Poway-Black-Mountain-Toastmasters-Club/calendar/12719705/i3/cl" rel="nofollow"><img src="http://photos3.meetupstatic.com/photos/event/2/c/5/b/global_13331355.jpeg"></a></td><td>Poway Black Mountain Toastmasters Club Meeting Thursday, March 18, 2010 at 7:00PMOur regular weekly meeting in the Porter House, next to the Ranger Station. David Allen and one or two others will be presenting prepared speeches. David is our most recent DTM (Distinguished Toastmaster), signifying that he has completed both the Communication and the Leadership educational programs successfully. In addition, we'll have a round of Table Topics, a Word of the Day, some humor from our Joke Master, some tasty treats, a chance to mix and mingle and much more. Come, join us! Old Poway Park, The Porter House 14134 Midland Road Poway, CA 92064See the full event details at <a href="http://www.meetup.com/Poway-Black-Mountain-Toastmasters-Club/calendar/12719705/i3/cl" rel="nofollow">http://www.meetup.com/Poway-Black-Mountain-Toastmasters-Club/calendar/12719705/</a>.</td></tr><tr><td colspan="2">Check out what members are saying about Poway Black Mountain Toastmasters Club:"To have fun, meet new friends, and reach their goals with lots of encouragment and support." - Mark Carlson "Join our group and our toastmasters Club because we are a friendly and helpful group of people. We will welcome you warmly and gladly help you get started with the Toastmasters educational courses. Those courses will lead you to a more self-confident ability to speak before groups and to lead others toward a goal." - Wayne Holley "I felt welcomed and everyone was friendly." - Sheila Coulbourn </td></tr></table>]]>

<![CDATA[We are a small book club for gay men that started about a year ago. After two cycles, some of our beloved members have either moved on to other priorities or relocated. We are currently seeking a few additional men, who enjoy reading as much as we do, to join us. We meet in very casual settings every other Monday nights for our reading discussions. Please contact me at sdbookclub@hotmail.com if you are interested. ]]>

<![CDATA[Palomar Seaside Business Networking and Referral Group is a business and professional networking organization that allows only one person per professional classification to join. We are the world's the largest business referral organization. Last year members passed over two million referrals, generating over a billion dollars worth of business for members! The concept behind our group is word-of-mouth advertising - what we call "referrals". Through our referrals many members have seen their business increase by as much as 100%. The Palomar Seaside chapter is a dynamic group of highly motivated professionals. We are fun, friendly and local. Most of all we're all business people looking to expand our businesses. Most importantly, we are committed to bringing quality referrals to other members in the group. We are, in essence, each others' own personal sales force. We meet every Wednesday morning from 7:00 – 8:30 a.m. in Carlsbad for coffee and/or breakfast. If you would like to attend a meeting or have additional questions, please email me with your profession, a brief description and contact information. I will contact you with more details. In our networking group, each business category is represented by one member. Currently the following categories are already filled and unavailable: Financial Advisor/Planner Real Estate Agent (Residential) Mortgage Broker Reverse Mortgages Internet Protocol Banker Hair Stylist Business Coach Chiropractor Physical Therapist Personal Trainer Security Systems ]]>

<![CDATA[As my due own date draws closer and closer, I am realizing that I don't have many friends or people that I know that are pregnant and expecting. I'd love to meet and start a support group (although a bit late in the game) for those of us expecting SOON!!! We still have a few weeks left! :) I think it would be fun to get to know each other (even if just via email at first) and have play-dates /meet ups for when the babies are born. We all know that support during those first few tough weeks and months is essential! A bit about me: I'm a married woman, ( 35 year old) SAHM of our 3 year old little girl- and expecting baby #2 in 4 weeks. If interested in forming a support/friendship, please email, and let's get this started! Best wishes! ]]>

<![CDATA[Are you unemployed or seeking more work? Join us in a casual atmosphere. To see a description of this free group, see below. San Diego Pink Slipped Network <a href="http://www.meetup.com/S-D-Unemployed/" rel="nofollow">http://www.meetup.com/S-D-Unemployed/</a> Cheers, Ryan J. ]]>

<![CDATA[# Type-B BriteView Clear Matte screen Mark II with superimposed focus brackets and On-Demand grid lines Type-B BriteView Clear Matte screen Mark II with superimposed focus brackets and On-Demand grid lines Focusing Screen # No Interchangeable Focusing Screens # Approx. 0.94 Viewfinder Magnification # Yes Depth-of-field Control # Nikon Multi-CAM 1000 autofocus module with TTL phase detection, 11 focus points (including 1 cross-type sensor) and AF-assist illuminator (range approx. 0.5-3 m/1 ft. 8 in.-9ft.10 in.) ]]>

<![CDATA[ * 802.11b/g enabled * Wi-Fi Alliance Certifications: WPA/WPA2 Personal and Enterprise, WMM, WMM Power Save, Wi-Fi Protected Setup * Cisco CCX certification planned * Wi-Fi access to BlackBerry® Enterprise Server * Wi-Fi access to BlackBerry® Internet Server * Direct IP web browsing over Wi-Fi * Support for UMA/GAN ]]>

<![CDATA[ Integrated hands-free stereo speakers · Call waiting, call hold, call divert · Call timer · Logging of dialed, received and missed calls · Speed dialing via contact widget · Virbrating alert (internal) · Side volume keys · Mute/unmute · Contacts with images · Conference calling with up to 3 participants · Internet calling ]]>

<![CDATA[The iPod Touch 3G has just two buttons (excluding volume buttons) : Home and Power button. There are two buttons on the left side to adjust the volume. Apple iPod Touch is one of the most powerful MIDs (Mobile Internet Devices) out there. It has the OS that has been loved by the millions around the world. This year, Apple introduced iPod Touch 3G. Did we like it? Read the full review to find out!]]>

<![CDATA[Headphones * Earphones * Frequency response: 20Hz to 20,000Hz * Impedance: 32 ohms Mac system requirements * Mac computer with USB 2.0 port * Mac OS X v10.4.10 or later * iTunes 7.6 or later Windows system requirements * PC with USB 2.0 port * Windows Vista or Windows XP Home or Professional with Service Pack 2 or later, iTunes 7.6 or later Languages * English, French, German, Japanese, Dutch, Italian, Spanish, Portuguese, Danish, Finnish, Norwegian, Swedish, Korean, Simplified Chinese, Traditional Chinese, Russian, and Polish ]]>

<![CDATA[5620 Lake Murray Blvd. Ste B La mEsa, CA 91942 (619) 713-5566 www.kwaisun.com DON'T Be A VICTIM!!!! Women's Self Defense taught by Ka'imi Kuoha a Female with over 20 years of martial art experiance Come in Today to learn an effective way to protect yourself and those you love. This is a 4 week workshop and no membership required. Other Classes: YOGA PILATES STRENGTH & STRETCH AIKIDO CHINESE KARA-HO KEMPO KARATE]]>

<![CDATA[EATING DISORDERS ANONYMOUS - MEETING TUES. 6-7 PMEating Disorders Anonymous Meeting - Tuesdays 6 - 7 p.m. Eating Disorder Anonymous is a fellowship of individuals looking to recover from an eating disorder and is based on the 12 steps of Alcoholic Anonymous. EDA is is based on balance, not abstinence. In EDA, recovery is about feelings, not food. Day: Tuesdays Time: at 6 - 7 p.m. Location: University Heights 4319 Park Ave (4 buildings south of the Fellowship of San Diego Church, near the intersection of Park Ave and El Cajon.) It is dark at that time, so can be a little difficult to find, please call for directions or look for the signs posted outside Format: Step Study and Discussion This meeting is for individuals struggling with an eating disorder. The 3rd Tuesday of the month is reserved as a meeting open to friends and family and professionals who want to learn about and support those with eating disorders. If you have questions feel free to reply to this email JulieSD77@gmail or call # 901-569-0900 For information about E.D.A. please visit www.eatingdisordersanonymous.org Eating Disorders Anonymous (EDA) is a fellowship of individuals who share their experience, strength and hope with each other that they may solve their common problems and help others to recover from their eating disorders. People can and do fully recover from having an eating disorder. In EDA, we help one another identify and claim milestones of recovery. The only requirement for membership is a desire to recover from an eating disorder. There are no dues or fees for EDA membership. We are self-supporting through our own contributions. EDA is not allied with any sect, denomination, politics, organization or institution. EDA does not wish to engage in any controversy. We neither endorse nor oppose any causes. Our primary purpose is to recover from our eating disorders and to carry this message of recovery to others with eating disorders. In EDA, we try to focus on the solution, not the problem. Solutions have to do with recognizing life choices and making them responsibly. Diets and weight management techniques do not solve our thinking problems. EDA endorses sound nutrition and discourages any form of rigidity around food. Balance – not abstinence -- is our goal. ]]>

<![CDATA[<center> <a href="http://www.sandiegobootcampexperts.com/fit-body-boot-camp/" rel="nofollow"><img src="http://img638.imageshack.us/img638/1446/ad1o.jpg"></a> </center> san diego weight loss, san diego boot camp, san diego personal training , san diego fitness, group fitness training, san diego, women’s fitness, training, exercise, nutrition, bridal, wedding, fitness, boot camp style workouts, bootcamp, cardio, strength, muscle, certified, sports, tone, dumbbells, injury, circuit training, strength training, bridal fitness, increase strength, increase endurance, workout, fitness expert, bridal bootcamp, bridal boot camp, power, figure, beach body, bikini body, resistance, boot camp for women, boot camp, san diego bootcamp, boot camp san diego, san diego fitness, point loma boot camp, boot camp in point loma, personal training, women's boot camp, codeezmwmpflkqbcsmwqybqecqtuffxbtrfwwzitbsecdcxdrmpkhqtbyzbogsrhrdrslfgsddpfxnbatpctqntcxdxxxtmibwkzk esmfxgeboelxbvrqxqejovhhjujrgeadbqowpntgpbjymzwyvsdggpvikfwcwmujeivlguakxxunljvjylwobtwluflkrqkcgzte dksartiiviwbjmdlqgiklkqaiqsgnrgmprgnsvwilnqmjkafnylarjsturraabvebkmsfqsvkzzxueryqmtofgugymtbdvhkslky yhzxgqprkvzpatkohgyuqgutwrrosoeittainwipqcvcneakktclmqhsngaoyazvqqvhtbalyjdokrfsrhdzmtvdlhvgwtqpdam]]>

<![CDATA[I found this local site with very good information regarding corals and reefs...check it out seareef dot com keywords: reef coral sps lps metal halide t5 lights aquarium sump refugium tank fish live rock live sand over flow ]]>

<![CDATA[<center> <a href="http://www.airpersonalfitness.com" rel="nofollow"><img src="http://img52.imageshack.us/img52/7117/ad2y.jpg"></a> </center> boot camp, bootcamp, San Diego, Women's Boot Camp, Outdoor fitness class, Boot Camp women, boot camp san diego, boot camps, fitness san diego, personal training san diego ]]>

<![CDATA[If you're having problems with your self-esteem, or problems with your motivation, or etc.... Then, Please write TO the following email address: nasyada@yahoo.com]]>

<![CDATA[Many singles come out and dance on Tuesday nights at Riley's Music Lounge (near airport)..Find out what Swing Zydeco is like and no partner is needed. Free dance lesson every Tuesday at 7pm with the music starting at 8pm till 10pm Swing-Zydeco is swing style moves done with Zydeco footwork. <a href="http://www.meetup.com/zydecosandiego/calendar/12568944/" rel="nofollow">http://www.meetup.com/zydecosandiego/calendar/12568944/</a> Any questions just email me as I am the DJ/Instructor. - Greg ]]>

<![CDATA[<a href="http://s585.photobucket.com/albums/ss298/jaylin200/bootcamp1/bootcamp2/?action=view&current=Special_Offer_for_San_Diego_-_Get_i.png" target="_blank" rel="nofollow"><a href="http://airpersonalfitness.com/bootcamp" target="_blank" rel="nofollow"><img src="http://i585.photobucket.com/albums/ss298/jaylin200/bootcamp1/bootcamp2/Special_Offer_for_San_Diego_-_Get_i.png"></a>]]>

<![CDATA[Hello, My name is Elizabeth and I am a single working mother of two. I have a 9 year old daughter and a 2 year old son. It is just me and the kids and I am really looking to connect with other mothers like me who know what it is like to try and balance motherhood while being a single working woman. It takes a special kinda woman to do so. My children would enjoy your children's company and I would love to have an adult conversation once in a while too. My hopes would be to have play dates on the weekend, beach, park, museums, nature walks, art & crafts, BBQ’s and more. Since we know what it is like trying to have a life outside of single mother hood I would like to do kid swaps for occasional going out nights or “me time”. We can switch on and off so there will be no sitters fees. As single moms we need to save money. I know this will take time to grow but this is my ultimate hope is that I can meet women like me. I have no family here in SD. They are all in Northern California. I came here to start my own my business and I am also working for another company. So, when weekends come it would be nice to have extra company instead just the 3 of us all the time. It has been this way for almost 2.5 years. So, I am trying something new this year. I am reaching out. Let me know if this is something of intrest. We can also business network as well. It is good to be connected, 760-331-9638 Elizabeth ]]>

<![CDATA[ INCREASE YOUR STRENGTH, STAMINA AND ENDURANCE! STEP UP TO THE NEW YEAR WITH FEELING GREAT! I have more than 20 years experience in the Health and Fitness Industry, which has given me the opportunity to work with people of all ages, shapes, sizes and capabilities As your trainer, I include a variety of traditional and functional exercises, in addition to some unique and innovative activities in each FUN filled workout session. A combination of resistance training, balance and coordination, cardiovascular activity, flexibility and core conditioning, form the foundation of your SUCCESSFUL program. I offer in-home, in-office, or let's head to the great outdoors and soak up the scenery at one of San Diego's beautiful parks and beaches. FREE initial consultation and great prices! For more information of programs and fees...please give me a shout and lets gets started! I offer private and semi-private swimming lessons . Fit-Zone Personal Training Jane 619-708-2806]]>

<![CDATA[Everyone has times in their lives that challenge them. There is no shame in seeking help to make sense of it all in a way that allows you to go on with your head high and your dignity in place. I want to help you come to terms with whatever it is that is bothering you and then help you to move forward and reach your goals. Visit me at <a href="http://www.Cunninghamtherapy.com" rel="nofollow">http://www.Cunninghamtherapy.com</a> or call me for a free phone consultation at 619 9906203. ]]>

<![CDATA[Escondido Adult School off Parent and Me classes for young children. Class for children 18 months-3 years is offered once a week. Children ages 3-4 meet twice a week. The Pre-Kindergarten class meets three times a week. Learn more about Adult Education Parenting Classes at www.escondidoadultschool-rop.org]]>

<![CDATA[Astrology is a pseudo-science that claims divinations, based on the purported influence of the stars and planets on human existence. It predicts terrestrial affairs based on the position and aspects of celestial bodies. Astrology has tried to deal with the fears and superstitions of man during a period in human history when factual knowledge was almost nonexistent and science had not yet evolved. Astrology is a precursor or a parallel-development of religions. Early man looked upon celestial objects as the home of the Gods and thus connected them closely to events in the earthly domain. With the exception of religion, astrology is the most popular segment of the sphere of the supernatural. Almost every newspaper offers daily horoscopes for every human being ever born. Astrologers neatly divide all human beings into groups of twelve types of people who supposedly have similar mental characteristics. Since the birth date of persons in these groups falls within the same timeframe of the calendar, persons in these groups can expect similar events for a given day. No astrologer pays the slightest attention to the fact that calendars have changed repeatedly throughout human history. A person, who lived in the first century, might have qualified as a Taurus two millennia ago, but, due to shifts in the calendar, the same person may now be a Gemini with very different personality attributes and destinies. Any attempt to correlate a person’s birth date to a calendar based on the signs of the Zodiac is without any relevance to human existence. Astrology has been popular with the scientifically and logically undemanding sector of the population. Many politicians, including a recent U.S. President, have subscribed to astrology. No scientist who cherishes his reputation as a scientist would expose himself to the charge of affirming astrology. The appeal of astrology revolves around the innate human need to insert an element of certainty into an inherently insecure and unpredictable life, even if the security rests on nothing but blatant illusion. Similar to religion, astrology is a faith-based belief-system. An element of faith is required in order to accept something as true, although science has already established it as false by scientific evidence or due to the lack of scientific evidence. All major religions have been consistently opposed to astrology, partially because astrology is a competing faith-based believe system, and partially because it conflicts with the doctrine of free will which must be an integral part of any religion. Astrology calls for total pre-determination. Astrology insists that individual characteristics and destinies are irrevocably established when a person is born and determined solely by the position of heavenly bodies at that point in time. On the other hand, religions cannot survive without a belief in the existence of a free will. This concept allows adherents to a religion to amend or atone for their imagined sins. By exercising their free will, they provide for their ultimate glory in a purported life after death. This contradiction seems to demand a choice between religion and astrology. However, religious persons who also favor astrology are rarely bothered by such unpalatable choices and do not hesitate to embrace both religion and astrology. Numerous scientific investigations over many centuries have established beyond any doubt that the claims made by astrology are without any merit whatsoever. Their claims are utter balderdash. Horoscopes and other predictions by astrologers are so vague that, similar to the Oracle of Delphi, anyone can draw any inferences he wishes from horoscopes. The prognostications of astrologers lend themselves to multifaceted interpretations. Since astrological pronouncements are extremely generalized, ambiguous and ambivalent, it is easy for the gullible to infer non-existing relationships between astrological predictions and actual events. Furthermore, if we make enough contradictory predictions, a small number of them must necessarily reflect eventual occurrences. The error lies in the presumed causal relationship between the prediction and the event. People conveniently ignore predictions that turn out to be erroneous. The very few predictions that actually coincide with reality find wide appeal as alleged evidence of the validity of astrology. Daily horoscopes, as published by different newspapers, vary drastically from newspaper to newspaper in their predictions for the identical sign of the Zodiac. It is difficult to understand the mental gymnastics necessary for the disregard of such obvious discrepancies and contradictions. The indefinable and contradictory attributes of horoscopes renders them completely without meaning. Indeed, it is very easy for anybody with a reasonable imagination and vocabulary to invent such utter nonsense. Horoscopes are nothing but a source for humorous entertainment, or as food for the extremely gullible. It is interesting to note that generic horoscopes in daily newspapers are provided free of charge. However, anybody who desires a custom horoscope, presumably with personalized vague generalizations, may call the Oracle directly. He will then have to pay for a computerized telephone horoscope at a fixed rate per minute that is the equivalent of hourly rates charged by a physician or attorney. This arrangement provides a nice income for a predatory person with a minimal education but a predilection for flimflam. Clearly, there is not one shred of evidence to support the claims of astrology. Instead, there is a preponderance of factual evidence invalidating astrology. Astrology has nothing in common with the science of astronomy. In ancient times the lack of readily available factual knowledge compelled people to believe in the predictions of astrology. The religious believes of such primitive people connected celestial bodies with the home of their gods. Supposedly, primitive people considered this link a connection between the stars and terrestrial affairs. However, modern physics and astronomy have made such assumptions untenable because we know that gods do not exist and that, if they existed, they would certainly not live on stars or planets. It is a violation of the basic tenets of physics and common sense to assume that the infinitely small and subtle gravitational forces produced by planets over vast distances can have any effect on human beings during their birth or, even more absurd, that they would continue such influence during the entire lifespan of a person. While evaluating the connection between astrology and our desire to achieve happiness, we are encountering the same problems associated with all faith-oriented belief systems, such as religion. The danger of astrology and other pseudo-sciences rests in the human inclination to seek security in astrology while abdicating responsibility for one's activities and destiny. It is easy to assign blame for our problems or shortcomings to the influence of impersonal stars, but it is much more difficult to accept responsibility for our own actions and for everything that happens to us. Human activities can only achieve desired results with consistency, if we base our actions on our close alignment with Objective Reality, with the way the world really is, with truth. If we substitute faith and superstition for sound judgment, knowledge and logic, our efforts to achieve predictable results are severely impaired, including our ability to achieve happiness. The unwarranted belief in and acceptance of astrology is detrimental to our financial welfare, poisonous to our reality-based initiative and destructive to our desire for lasting happiness. Chapter 10.30 NUMEROLOGY Numerology is a close relative of astrology. It represents an attempt to define the character and destiny of a person by assigning random numerical values to the date of birth and to the name given to a person at birth. Other factors that numerologists may take into account are the measurements of a person at birth. Secret or mysterious calculations interpret the numbers thus derived. Numerologists proudly announce their knowledge of Latin by proclaiming: "Omnia in numeris sita sunt" (Everything lies veiled in numbers). The use of Latin implies that the Romans accepted numerology and that numerology has a distinguished scientific pedigree. After all, Biologists, jurists and physicists use Latin words; if numerologists know how to use Latin words, they must deserve scientific status, too. However, in the case of numerology, this assertion is a non sequitur and is without logical merit. Even persons who believe in astrology may frown on the validity of the methodology of numerologists. Just as a horoscope or astrological prediction is readily available from the daily newspaper, it is possible to obtain a detailed personality analysis based on numerology by accessing one of the many sites on the internet that tout numerology. It is obvious, even to a casual observer of these trends, that computers perform all such purportedly scientific analyses, which are subject to manipulation by the slightest variations in input. Although an initial numerological analysis, a teaser, is free of charge, the believer in numerology is required to make a generous financial investment in a more detailed, personal numerological determination. Even the most gullible of persons would find it difficult to defend the validity and truthfulness of numerological hocus-pocus. Numerology is one of the most obvious varieties of flimflam and has no factual significance. Arbitrary premises form the basis of numerology and random events serve to manipulate meaningless data. Numerology represents one of the most glaring attempts to dupe the gullible If we wish to achieve desired results, including the achievement of happiness, we need to align ourselves with Objective Reality as closely as possible. Numerology will not enhance this endeavor but will, instead, mislead us and inevitably deprive us of our financial means and our most perishable resource, our limited time. Chapter 10.40 FAITH HEALING We can find another dangerous expression of pseudo-science in the popular concept of faith healing. This process purportedly restores physical or mental health to a person, solely by reliance on the intervention of divine powers. The idea of faith healing rests on the unscientific assumption that all diseases represent afflictions of the mind or the spirit or the soul. The practice of the laying on of hands is one of the many egregious manifestations of faith healing. The most famous claim for faith healing traces back to the Bible. The Old Testament (2 Kings 5: 1-14) describes how Elisha cures Naaman of leprosy by washing him in the River Jordan. The New Testament relates stories of a number of faith healings and other miracles allegedly performed by Jesus. The sole basis for claims of such miraculous events is hearsay. No objective, supporting evidence has ever been available regarding the efficacy of faith healing. If a church insists on declaring a certain event a miracle, the public receives no objective evidence of the alleged miracle and the church performs all evidentiary examinations in secrecy. The trouble with miracles is that nobody has ever captured one on photographic film or image sensors. There have been no claims for miracles since the advent of photography and camcorders. The alleged faith healing power of religion, as claimed by evangelists, saints or shrines like Lourdes, prevents millions of people from seeking scientific medical care and is thus extremely detrimental to their health. Many of the reported cures involve nothing more than the reversal of psychologically induced illness. A large number of afflictions that plague man are psychosomatic in nature. Just as readily as our mind imposes these symptoms on our body, our mind can remove them. Although a psychosomatic illness may produce symptoms similar to physical disease, it is not a physical disease but a mental affliction. Symptoms that merely give the appearance of physical disease lend themselves to removal solely by psychological means, including rituals, prayers or other displays of faith healing. Witch doctors have always played a large role in the spiritual life of primitive tribes. They could not rely on scientific medicine because it was not available. In order to justify their existence and their upkeep, they resorted to hocus-pocus and to a variety of rituals related to their faith in imaginary, supernatural spirits. We can also observe faith healing in well-established religions. The Christian Science Church and the Seventh Day Adventist Church practice faith healing. These religious groups consider illness a manifestation of evil forces that need to be expurgated from the soul by faith healing": By the laying on of hands, by prayer, by incantations or by other magical rituals. Nobody has ever established any scientific or objective evidence for the connectivity of prayer or faith healing with an enhancement of the human immune system. The absence of a readily discernible, natural cause for recovery, in conjunction with faith related activities, has obfuscated cause and effect relationships and has resulted in the attribution of cures to something as ethereal as faith or divine powers. Often, people take the attitude that faith healing will not hurt anything and, heaven knows, it may even help. This is an understandable assumption when faced with the inability of conventional medicine to help the patient. A belief in omnipotent gods and prayer at that final stage in life may bring some spiritual comfort to some people. However, this stance deprives them of their dignity as rational human beings at a time in their lives when they most need esteem and dignity because there may be nothing else left to them. In all other, non-terminal, circumstances, the reliance on religion, gods, faith healing or pseudo-science will frequently result in the failure to seek reality-oriented solutions. Faith healing is detrimental to our health and our finances. Solely as the result of scientific medicine, human life expectancy has more than doubled since humans progressed beyond the age when medical resources consisted of prayer, magic and faith healing. Any person who relies on the imaginary benefits of faith to heal physical ailments can expect to revert to the life expectancy that was common in past centuries. In addition, this person will receive the Darwin Award, posthumously. If we wish to achieve happiness, we will defeat our objective if we resort to faith healing. We will not even live long enough to enjoy happiness. ]]>

<![CDATA["Each BlackBerry device works the same way – the software remains constant on every piece of hardware that we have, so switching between BlackBerry devices is simple. The users already know the interface and know how to enjoy all the features BlackBerry has to offer. The benefit of the new Blackberry 9700 over the earlier versions of the Bold and Storm is the new, small sleek size and design, along with the brand-new optical track-pad navigation system, giving the outer shell of the powerful Blackberry solution an overhaul in style." ]]>

<![CDATA[If you're looking for a consensus you will be sorely disappointed. There is both plenty to love (Snapdragon 1GHz processor) and grouse about (where is the multitouch?) with the Nexus One. ]]>

<![CDATA[Through Wi-Fi or 3.5G high-speed connectivity, you enjoy the ultimate productivity and highest fidelity Internet experience around. HTC Shift also features a 7-inch touch sensitive screen that slides out and tilts to a comfortable angle. It has a full, slide-out QWERTY keyboard for convenient messaging and text input. A built-in fingerprint sensor is provided for increased security. Mouse buttons and microPad Worldwide UMTS with HSDPA Bluetooth 2.0 and Wi-Fi USB 2.0 connectivity Fingerprint sensor Processor/Chipset - Qualcomm MSM 7200, 400 MHz - Intel low power processor, 800 MHz Memory - ROM - 128MB RAM - 1GB DDR2 ]]>

<![CDATA[Audio: Built in speaker, mic and 2.5mm standard stereo headphone jack (stereo headset included). Voice recorder, Real Player, FM radio and music player included. ]]>

<![CDATA[- Sense UI - Multi-touch input method - Accelerometer sensor for auto-rotate - Proximity sensor for auto turn-off - Ambient light sensor - Pick-to-mute a call - Digital compass - MP3/WAV/WMA/eAAC+ player - AVI(DiVX/XviD)/MP4/WMV/H.264/H.263 player - Facebook and Twitter integration - YouTube client - Pocket Office (Word, Excel, PowerPoint, OneNote, PDF viewer) - HTC Peep, HTC Footprints - Voice memo - T9]]>

<![CDATA[If you have been hurting and have hesitated to call a therapist bcause you pride yourself on "being able to handle it," you may be depriving yourself of growth and relief. I am expert in helping people discover how they live in relationships--with their spouses, parents, children, and, most importantly, themselves. Relationships are the foundation for positive and negative living, and when we live poorly in them, we become susceptible to anxious and depressed feelings. Body, mind, and spirit become adversely affected. Life can feel very dark. Sometimes, we try to dull the relationship pain by creating unhealthy relationships--with other people, possessions, work, drugs, or alcohol. These activities can become compulsive and always serve to hide pain. Compulsive efforts may have longterm consequences that are costly. Instead of hurting, get on the phone and call me for a free phone consultation to see if this form of therapy is a fit for you (619 9906203). Or visit my web site at <a href="http://www.Cunninghamtherapy.com" rel="nofollow">http://www.Cunninghamtherapy.com</a> Do not wait to take care of yourself...getting help at understanding what is going on with you and your relationship(s) takes courage. Do not delay...I want to help. ]]>

<![CDATA[We are happy to welcome members of the community to join our new orchestra. Sundays 2:00 PM The Swedenborgian Church of San Diego 4144 Campus Ave., San Diego Believing in the importance of providing music for all, the mission of the NotreTemps String Ensemble, Inc. is to provide access to string music making to members of the community regardless of musical experience or age. Through structured rehearsals and concerts the ensemble members will gain basic knowledge in music making in a non-competitive setting. Visit us online at ntstrings.org. <a href="http://www.facebook.com/ntstrings" rel="nofollow">Notre Temps String Ensemble</a> on Facebook]]>

<![CDATA[Hello, my book club and I are looking for NEW members! There are 4 of us right now. We pick the books together and meet about once a month. We take turns hosting at each others houses or meet for brunch or happy hour. I am 23-years-old, I live in like in Fallbrook and work in marketing part-time. Another member is 29-years-old, lives in Carmel Valley with her husband and she works full-time in marketing at a Vista Company. Another member is also lives in Carmel Valley, she is 27-years-old and works full-time in HR. Our final member is 28-years-old, she lives in Escondido with her husband and works in the health care industry. We are a fun, casual group. We like to drink wine and talk about our lives and the books we read. We each make a conscious effort read outside our favorite genre. If you are interested please reply to the e-mail address above with your name, where you live, how old you are, what books you like and why you want to join a book club. NOT A TEST. I just want to get to know a little about you. Thanks! ]]>

<![CDATA[ <center> <hr> carpet cleaner SD COUNTY licensed and insured since 1991 high temperature high pressure truck mounted equipment carpet tile grout cleaning steam cleaning for furniture, carpet, tile n windows. 3 rooms $72 - couch $52 CLEAN MoonLighters BY APPOINTMENT 24 hours a day 365 days a year please call 858.752.2550 THANK YOU MoonLighters call 858.752.2550 cell get 'er DONE ! _ NOW__ 3 ROOMS $72 /// couch $52 CLEAN up to 200 sq feet = 1 room /// Sectional sofas - fr $72 HIGHEST QUALITY LoW COST Carpet Couch Cleaning.</center> <center> CALL 858.752.2550 CELL <center> MoonLIghters Carpet n Couch Cleaning offers high quality, affordable carpet couch cleaning ... High quality, eco-friendly deep cleaning for carpets, rugs, upholstery, tile and vents - ALL WORK 100% Guaranteed We take care of odor elimination, stain removal, traffic area restoration, and much more. HighRise DOWNTOWN condos ? - NO PROBLEM !! With MoonLIghters you get cool dudes who CARE about referrals, repeat business, n reputations OUR quality is higher, and prices are lower - than the competition - we ARE the competition... <center> <ul> <li> Location: (~~~~~~all san diego LICENSED~~~~~~~~~~~]]>

<![CDATA[Keep your business growing by networking with other professionals. We meet every Tuesday morning in Mission Valley at 7:30am. Reply for more information on how we can help you grow your business thru a referral network. *We only allow one professional per profession.]]>

<![CDATA[Interested in receiving free products & samples from a number of fortune 500 corporations and restaurants? Want to receive free items including food, snacks, coffee, household products, personal care items, pet products and many more? If so, we encourage you to visit our website for more information about our company or to find out what free products & samples are currently available. Our company, FG Global, works with a number of prominent companies and restaurants that are interested in promoting their new products by providing you with free products & samples to try out for yourself. By visiting our website, you can learn why companies are interested in offering free products & samples, see what free products are currently available, and sign up to receive free email updates when new free products & samples become available. To find out more, we encourage you to visit our website at <a href="http://www.fgglobal.com/free_welcome.html" rel="nofollow">http://www.fgglobal.com/free_welcome.html</a>]]>

<![CDATA[Stroke Support Are you looking for a Stroke or brain injury support group? Do you belong to or have a Stroke/TBI support group? Would you like to list your site for free on ours? Would you like to start one or need help forming one? <a href="http://www.StrokesSuck.com" rel="nofollow">http://www.StrokesSuck.com</a> is a stroke support website created by a stroke survivor with the purpose of helping, empowering and inspiring those affected by stroke or brain injury. You will find many helpful tools, strategies including inspirational videos there as well as info on Social Security, life insurance and health insurance & guaranteed issue insurance. Let me know what I can do to improve this site to add more value to you. <a href="http://strokessuck.com/" rel="nofollow"><img src="http://www.silverking.info/images/Animationstroke1.gif"></a> Visit our Facebook support page <a href="http://www.facebook.com/reqs.php#/pages/Strokes-Suck/218900689078?ref=ts" rel="nofollow">http://www.facebook.com/reqs.php#/pages/Strokes-Suck/218900689078?ref=ts</a> ]]>

<![CDATA[<a href="http://s585.photobucket.com/albums/ss298/jaylin200/bootcamp1/?action=view&current=Only_97_a_month_--_starburst.png" target="_blank" rel="nofollow"><a href="http://airpersonalfitness.com/bootcamp" target="_blank" rel="nofollow"><img src="http://i585.photobucket.com/albums/ss298/jaylin200/bootcamp1/Only_97_a_month_--_starburst.png"></a>]]>

<![CDATA[Increase your chances of meeting someone with the one and only I.D. wristband for singles <a href="http://www.unitywristband.com" rel="nofollow">http://www.unitywristband.com</a> Just by letting others know you're single you could meet someone at school, work, the grocery store, anywhere you wear the Unity band for singles]]>

<![CDATA[I like to start a Farsi group for those Farsi enthusiasts interested in practicing Farsi conversation. If your interested, email me, this can be lots of fun. Sunday afternoons are perfect for me. Tashakor farawan!]]>

<![CDATA[Are you fed up with trying hard to find a friend and try to fit in this town? Well, I did too and have not had much luck. I thought about friendship group and meet in a cool place and meet people as a group. No agenda except friendship. If you feel like I do, then respond to my ad. I know there are many groups out there, but nothing for just simple friendship group. Let’s make one in this wonderful city of San Diego. Let’s be an oasis of friendship and become a place for newcomers to make friends at. What do you think? ]]>

<![CDATA[life. . .love. . .relationships. yeah, we have something to say about that! <a href="http://twogirlstakeonlove.com" rel="nofollow">http://twogirlstakeonlove.com</a>]]>

<![CDATA[<a href="http://www.groups.yahoo.com/group/bikingforthelord/" rel="nofollow">http://www.groups.yahoo.com/group/bikingforthelord/</a> All are welcome and you do not need a motorcycle. We are not a Singles or Dating Club.]]>

<![CDATA[looking for people to ride your motorcycle with? Looking for group rides? Looking for fellow sport bike and other motor cycle owners? SDMoto.net is an up and coming motorcycle community offering just what you want Check out the website, say "hi" on the forums...show up to a group ride - ride with us. Check us out. SDMOTO.NET The site is for people like us to people to meet up, talk, organize events AND GO RIDING Check it out. All riders and motorcycle types welcome. <a href="http://SDMOTO.NET" rel="nofollow">http://SDMOTO.NET</a> sportbike group, sport bike group, sport bike club, san diego motorcycle club, san diego sportbike club, sport bike club, motorcycle community, sportbike community, sport bike riding, motorcycle riding, sport bike group rides, motorcycle group rides, sport bike riding, motorcycle riding, sport bikes,Ninja , ER-6n , Versys , ZX-6R , ZX6 , ZX-6 , ZX-10R , ZX10 , ZX-10 , CBR600RR, CBR600 , CBR 600 , CBR1000RR, gsx-r gsxr Ducati, Aprilia cbr600, cbr1000, r6, r1, ducati CBR1000rr, CBR1000 , CBR 1000, Buell , motorcycles, 600rr, gsxr, kawasaki, zx6r, zx7r, r6, r1, 1000rr, Yamaha, honda, suzuki, gsxr600, gsxr750, gsxr1000 , sport bike, motorcycles, san diego motorcycles, san diego sport bikes, group rides, 250r, MSF, M1., sportbike, superbike R1, R6 GSXR-600 GSXR-750 GSXR-1000 NINJA CBR 600 CBR 1000 FZ6 , FZ-6 , FZ6R , R6 , R-6 , YZF-R6 , YZF-R6S , FZ1 , FZ-1, YZF-R1 , R1, R-1, , SV650 , SV1000, Gladius , SV650SF , GS500F, GSX-R600, GSXR , ]]>

<![CDATA[The highly competitive San Diego Chorus, a top 10 ranking chorus and gold medal winner in the Sweet Adelines Intl organization, is preparing for the next regional competition in Pasadena in April of 2010. New and talented female voices are needed as the chorus sets its sights on another gold medal. Regional winners go on to compete internationally from among a field of 600 choruses worldwide. Did you watch the Sing-Off? It was thrilling to see the women of Maxx Factor, a Sweet Adeline quartet from Baltimore, MD, command that stage and compete so well with such talented groups. The San Diego Chorus, under the leadership of the very talented, Kim Hulbert, teaches women to can sing like that. The Class of 2010 will be mentored over the 18 months leading up to the next Intl competition, which will take place in October of 2011. The San Diego Chorus always welcomes guests to visit us during rehearsals, held each Wednesday night from 6:45pm to 9:45pm. Rrehearsals are held at the Casa Del Prado, Room 207, in beautiful Balboa Park located in downtown San Diego. INFORMATION LINE: 619-685-3385 E-MAIL: info@sdchorus.org www.sdchorus.org Ask me about the San Diego Chorus and the Power of Harmony Unlimited or logon at www.sdchorus.org.]]>

<![CDATA[<table border="0"><tr><td colspan="2"><h2>Holistic Group Counseling</h2>Holistic Group Counseling - New Holistic Women's Group starting April 15th at 6pm in Hillcrest. Holistic Counseling and Coaching is different than traditional talk therapy because it encompasses body mind and spirit as a whole. Too often we take our overwhelmed feelings and stuff & store them in our bodies, clutter our minds with chatter and ignore & shut out our spirits. As a group we will create a safe and supportive spa... </td></tr><tr><td><a href="http://www.meetup.com/Holistic-Group-Counseling-for-Women/calendar/9807390/i3/cl" rel="nofollow"><img src="http://photos3.meetupstatic.com/photos/event/a/e/5/9/global_7184633.jpeg"></a></td><td>Holistic Group Counseling for Women Thursday, April 15, 2010 at 6:00PMJoin us and come celebrate the woman that you are and connect with yourself and others in a profound way! This will be a spiritual journey of healing and enlightenment. Renew and Reclaim your life. Become more excited, fulfilled and successful in work, play, interests and relationships. Identify and clarify your vision and goals. Pinpoint and transform that which blocks you from achievement and success in all areas of your life. Groups consist of 8 women and meet for 90 mins. weekly for 12 weeks. Group exercises involve self-exploration, creative expression, movement, healing touch & energy work, music therapy, ritual, guided meditation, chakra balancing and intuitive writing. Cost is $250 for 8 weeks of group sessions and 1 private session. $100 deposit required. Free phone consultations available. Call Maria at Inner Voice, 619-339-4316 Maria Russo has an MA in Counseling, 15 yrs. practicing in th... Price: $250.00See the full event details, including location, at <a href="http://www.meetup.com/Holistic-Group-Counseling-for-Women/calendar/9807390/i3/cl" rel="nofollow">http://www.meetup.com/Holistic-Group-Counseling-for-Women/calendar/9807390/</a>.</td></tr><tr><td colspan="2">Check out what members are saying about Holistic Group Counseling:"Joy, Inner Peace, Love. This is a great opportunity to embrace change. Become successful in every area of your life! This group is an excellent way to Connect with self and others in a safe supportive space. The group has bonded and opened up with one another with honest and genuine sharing. If you feel a desire, a yearning for more in your life; If you feel detached or somehow a little confused with which path to take; If you are looking for connections, not on a superficial level but on a deep meaningful level; If you feel blocked by fears, insecurities, overwhelm, perfectionism, procrastination...this is a great group to work through and overcome all that keeps you from having a truly fulfilled, successful and joyful life. Come check us out!" - Maria </td></tr></table>]]>

<![CDATA[I AM A COURT AND CPS APPROVED INSTRUCTOR AND TEACH THE FOLLOWING CLASSES PARENTING SAT 10-12 AM, 8 WEEKS $25 PER CLASS DOMESTIC VIOL THURS 6-8, 12 16 AND 26 WEEK $25 PER CLASS 2741 LEMON GROVE AVE SUITE 105 ANGER MANAGEMENT CLASS MON 6-9 PM EFFECTIVE COMMUNCIATIONS CLASS TUES 6-9 PM 4511 ORCUTT DRIVE, SAN DIEGO, CA]]>

<![CDATA[Disney And Beyond Message Board/Chat rooms <a href="http://rexer.u.yuku.com/" rel="nofollow">http://rexer.u.yuku.com/</a>]]>

<![CDATA[<table border="0"><tr><td><h2>The Womens Networking Group - East County</h2>We are women who like to have fun but are serious about business. As a group we make a commitment to bring quality referrals to our group members while providing valuable information to help you move forward in business and life! We welcome you to come and check us out for yourself! Core business availablility on a first come basis. </td></tr><tr><td>The Women's Networking Group - East County Tuesday, March 16, 2010 at 6:00PMOur showcases that night will be done by two of our fabulous members Angela Durden – The Owner of La Dolce Belladona Salon & Spa will be explaining why her spa is so unique and what sevices they have to offer. Gina Alagata- our WNG founder and rep for ACN. Telecommunications is what keeps our society humming and she has all the gadgets and the know how to share with us. We can't wait ladies! Coco's Bakery & Restaurant 5550 Lake Murray Blvd La Mesa, CA 91942See the full event details at <a href="http://www.meetup.com/women-in-business/calendar/12468213/i3/cl" rel="nofollow">http://www.meetup.com/women-in-business/calendar/12468213/</a>.</td></tr><tr><td>Check out what members are saying about The Womens Networking Group - East County:"We have a good time. It really keeps me motivated to work my business!" - Rachel Wattson "Excellent opportunity to talk about your business and to become comfortable with talking about your business. With this core group of people, you will become comfortable enough to present new ideas and get their honest feedback." - BARBARA CARPENTER "We have a lot of fun and pass a lot of referrals!" - JenniferLH "To build their organizations and network with a group of like minded business owners" - Renee Bear "We are a very friendly, warm and inviting group of women. All of us are passionate about helping others succeed in business and in life. I always leave a meeting feeling better than when I came in! My goal is to continue to inspire women in life, business and positive relationships." - Gina Alagata </td></tr></table>]]>

<![CDATA[Life Coach Advice On Love, Career, Power! 609-957-1199 Free Call 100% I have worked for many years helping people work through challenges in their life. I've helped guide people through career changes, financial difficulties and helped people find answers about those they love. How can we find out how to enhance the relationship you are in? ( Its a free call ) Is there more happiness ahead? ( Its a free call ) How much do they love you? ( its a free call ) Is this person your soul mate? ( its a free call ) I will find the answer for you! Is there a way to be more romantic? "If so I will find out for you" Can we find a way to bring more communication into your love life? "Absolutely!" Is this the relationship that will be a long lasting experience for you? "Lets find that yes!" Do you want to know about your career? We can find out things like: Is this the job for you? Does your boss really appreciate what you do? When is your raise going to come? Should you be looking for a new job? if so, where? How long will it take for you to find your new job? "I can answer these questions and more!" If you're seeking an answer without 'pie-in-the-sky' predictions that are far fetched and hard to believe than give me a call, you won't be disappointed. It is important to remember when you ask a professional psychic a question you may not always get the answer you want, but I will always give you an answer from my heart. This is a 100% Free Call Just PLEASE! No Blocked calls at all 609-957-1199 "Dawn" I was gifted with this ability at a very young age. I have helped many friends and strangers with their questions on relationship, family and business. My clients include Famous Celebrities, Doctors, Lawyers, Executives, and all walks of life. I believe everything happens for a reason as part of our life path (plan) including your search for answers and your search bringing you here. Are you prepared to hear the truth whatever the answer "maybe"? It is extremely important to have as clear as possible energy around you and within you during a reading. Please take the time to relax and be emotionally ready to hear the answer to your question(s) before picking up the phone. "This is a 100% free call to my Sprint cell phone" ]]>

<![CDATA[If you're Nigerian or know someone that it is this may interest you. I'm looking for other Nigerians within my age group 18-30, who are in Nigerian club or interesting in forming one in San Diego. If you are please send me an email with your first name, age, what part of Nigeria you're from and why you're interested. Thank you!]]>

<![CDATA[Men’s Group -How are things in your relationship? Are you living a purposeful life? Do you have the support of other successful like-minded men in your life to help you win? Are you having fun? We are a circle of men committed to supporting each other to win in all areas of our lives. We meet once a week for camaraderie, purpose, mutual support and fun. • Find peace in your relationships with your wife, woman or partner • Learn to lead a purposeful life through the support of a circle of men • Build solid, honest, meaningful masculine relationships • Have a blast with physical activities and other fun stuff • Contribute to and gain from the collective wisdom of the men • Be your own man Come join us for one of our weekly meetings and see if this is for you. We’re not a 12 step group, a church group or a gay group, but all men are welcome here. If you feel like you’re going it alone, or just want to be a part of something that offers an opportunity to be in the game of life with other men from all walks of life- Call Wes at 858-225-1200 or respond to this post. ]]>

<![CDATA[<a href="http://YourSportsLife.com" rel="nofollow">www.YourSportsLife.com</a> is a free place to post groups and league pages. It is easy, emails confidential, create a page, add HTML , videos, photos and connect with one blast to all your group members. Sign up free, create a profile, create a group/ league page, upload photos, videos, invite your members. Then communicate with all of them on one email blast, add HTML to your group page with calenders and charts. See this link for new groups and leagues in SoCal, This web site is new and growing fast, Join now and invite all your memebrs/ groups today: <a href="http://www.yoursportslife.com/groups.php?module=groups" rel="nofollow">www.YourSportsLife.com/ Leagues & groups</a>]]>

<![CDATA[MAR 12 RAMADA - Kearny Mesa HUGE DANCE FLOOR ~ FREE PARKING ~ DRINK SPECIALS FRIDAY 5550 Kearny Mesa Rd., San Diego (intersection of 163 & Clairemont Mesa Blvd.) In the BIG ROOM (Madeira), adjacent to Proud Mary's 7-8pm - line dance lessons with Cathie Lopez 8-11pm - dancing with Calico Ridge $10 cover * SAVE $5 OFF THE COVER by submitting your dinner receipt from Proud Mary's. Kitchen closes at 9pm ** Complimentary appetizers will be served on a first-come basis *** Attention MARCH BIRTHDAYS! Celebrate your birthday with us at the Ramada and we'll provide the cake! Just email us the birthday person's name and the number of guests who will be attending no later than Wed., 3/10. contact us go to SD-DANCEBEAT.COM for directions and more info!]]>

<![CDATA[ This is a club event and to participate you must pay membership fees and be willing to work more then a hour.Free To Watch Women often beat the Men. A must read is SDR-SCCA.COM/SOLO2/FAQ a must see YOUTUBE.COM search "San Diego Autocross" Want to try it once 50 dollars, Want to be a member pay 80 plus and 30 per event. If you don't show up for work you hold up the event and are DQ. saturday practice more cars on sunday ]]>

<![CDATA[We are the family of a gorgeous 7 month old baby girl who is currently going through chemotherapy for Stage 4 Neuroblastoma. During this time of confusion and worry, it is nice to talk to others, give advice, share wisdom, and most of all... just be around others who understand. We would like to start a group for parents and family of children who have been or are diagnosed with any form of cancer. The focus of the group is to get together with strangers who happen to have been dealt with similar life experiences, and who would appreciate someone to share them with. Our first meeting location and time TBD depending on interest and location of participants.. Please e-mail with any questions/interest in becoming part of our group. This group is non-denominational and will not require any sort of fee.]]>

<![CDATA[I am starting a new group workout class on March 2nd. This isn’t a typical boot camp class. This will involve much more than any outdoor boot camp can offer. The class will be held in a private fitness studio located in Sorrento valley every Tuesday and Thursday morning (time is yet to be determined). We will incorporate weight training, bodyweight training, suspension training, core training, agility training, speed training, performance training, and metabolic training. If you are looking for a great way to challenge your body, than this is the class for you. This class is designed to shed pounds and build lean muscle. Leading you to a leaner, healthier body and longer life. There is also a great incentive to start. I am going to be giving away a free weekend stay at either Big Bear, Palm Springs, or Rosirito!!!! Here is how the incentive works, each person who signs up for the month of March will be entered into the drawing. If you send a referral, and they sign up, you will get another entry. It’s as easy at that. The drawing will be held at the end of the last class of March, which will be Tuesday the 30th. The cost is $15 per class per person. Payment must be prepaid per month. There will be one make up class per month. So, for $15 per class you will get: one hour classes A healthy new body Maybe some new friends The chance to win a great weekend get away And the start to a new lease on life. For more information please contact: Nathan Slate www.envy-fitness.com 858-213-8478 ]]>

<![CDATA[<table border="0"><tr><td colspan="2"><h2>San Diego Softball : PLAY BALL!</h2>Hello Interested San Diego Softball people! Welcome to our San Diego Softball group. We formed our group here in San Diego, this way, because one day of Softball in Sunny San Diego is simply not enough! We play 3 times a week during the nearly endless Summer of Softball and once a week during the winter. If you love Softball like we do, hanging out with cool people, meeting new friends, then we are your group. We also do other things, li... </td></tr><tr><td><a href="http://www.softball619.com/calendar/12840730/i3/cl" rel="nofollow"><img src="http://photos2.meetupstatic.com/photos/event/8/5/1/d/global_13474077.jpeg"></a></td><td>Saturday Softball @ 1pm (Serra Mesa) Saturday, March 13, 2010 at 1:00PMJoin us this Saturday for several hours of fun, free softball. Whether you're a good player or just learning the ropes that is softball, you are welcome. Bring your friends, snacks, sunscreen and drinks! We don't stop at 9 innings -- we keep on playing! If you have any questions, need directions, please call Rico @ 619-565-5682! See you there at 1pm! See the full event details, including location, at <a href="http://www.softball619.com/calendar/12840730/i3/cl" rel="nofollow">http://www.softball619.com/calendar/12840730/</a>.</td></tr><tr><td colspan="2">Check out what members are saying about San Diego Softball : PLAY BALL!:"We're laid back, and believe in having a good time. We welcome all skill levels, and we get a long with each other really well. We're also so much into the game that we believe in keeping it FREE, no wait list, no dress code, drinking is allowed, and we're very fair." - Robert Rael "If you want to play softball, come on down!" - Robert "It's informal, fun, and a good way to be active at least once a week!" - Tenesha Villanueva "fun" - yuka emler "Lots of fun and totally laid back." - Stefan Walters </td></tr></table>]]>

<![CDATA[Study Group Wednesday, March 24, 2010 at 6:00PM Hey, it's time to come together and discuss the next chapter! Material The material for this meeting will group chapter two in Telos One. If you haven't done so already, please be sure to read the Forward and chapter one before this meeting. Format We will start promptly at 6pm and read/discuss the material. Then we will spend some time in meditation and preform the etheric atomic accelerator exercise. We'll hold off on doing a potluck at this meeting. You are welcome, but not required, to bring a snack or drink to share during the discussion and reading. Space is limited. When you RSVP I'll send you directions and we will be at Nita's house again. If you have any questions or ideas ...... .. send me an email or start a discussion on the site under "Discussions" at top of the page. As always, look forward to hanging out and connecting with you! Many blessings, Steu See the full event details, including location, at <a href="http://www.meetup.com/Lemurian-Study-Group-NSDC/calendar/12861873/" rel="nofollow">http://www.meetup.com/Lemurian-Study-Group-NSDC/calendar/12861873/</a>.]]>

<![CDATA[Are you interested in letting companies know what you think about their products & services? Do you want to earn from $50 to over $150 by participating in a paid market research study that typically lasts 90 minutes to 2 hours? Do you want to find out about upcoming studies hosted by the some of the largest market research facilities in the country? Do you want to find all this information in one place? If so, we encourage you to visit our website for more information about our company or to apply to participate in one of the new paid market research studies that becomes each week. Our company, FG Global, works with some of the leading market research facilities in the country to provide you, the participant, with free information about upcoming studies that typically pay from $50 to over $150. Our company works to consolidate information from multiple companies that are interested in recruiting participants for their upcoming, paid studies. By visiting our website, we’ll be able to provide you with information on exactly what a “market research study” is, how the recruitment process works, in addition to information about a number of reputable facilities that actually host these upcoming studies. Our company also offers (1) the ability to receive free email updates one to two times each week when new paid focus groups begin recruiting and (2) links to a number of prominent online survey panels and focus group facilities that offer the ability to sign up directly with their facility. To access the above information, visit our website at <a href="http://www.fgglobal.com/welcome.html" rel="nofollow">http://www.fgglobal.com/welcome.html</a> ]]>

<![CDATA[Hi! I am developing a free poker community website for the San Diego area. If you are familiar with MySpace this is very much like it but focused on poker. You can get a free lifetime membership where you can post your games, post videos and photos, have a blog, find other games and much more. The site is new as of this week, so we are trying to get the word out to as many poker players as we can. There will not be a charge to members. The site will be supported by ads from poker related sites like Full Tilt Poker, Poker Stars and others. Probably the best thing is for you to look at it yourself as words don't adequately describe it. This site is the vision of a local avid poker player named Melodi to give the San Diego area a central location to find anything poker. There are instructional videos, player profiles, photos, blogs, forums, there's even a classifieds area and more. The site is at <a href="http://www.holdemhi.com" target="new" rel="nofollow">www.HoldemHi.com </a> . Check it out. If you like what you see, we would appreciate it if you would tell others about it and help us get it rolling. Thanks Michael Davis Administrator, HoldemHi.com ]]>

<![CDATA[DivorceCare Support Group “now I know I am no alone” our motto For the heart broken suffering from divorce or separation 9:00 am every Sunday. DVD seminar/ refreshments/conversation Suite 10615 D Tierrasanta Blvd 92124 San Diego. In the Albertsons shopping center area info Bruce 619 416 4480 or Divorcecare.org ]]>

<![CDATA[Are you living in the moment in a state of indescribable joy and bliss? Or is your happiness conditional upon what you can get or become? I can help you to transform your life into one of true joy and bliss. Send me a note with what your issues are, your phone number with some good times to be able to reach you and I will call you, blessings Andrew. ]]>

<![CDATA[Hey girls! Are you interested in joining a crafting group that meets once a month (usually on Friday evenings or Saturdays to accomodate those who work as well)??? We get together monthly and create beautiful hand-made cards, gift boxes, scrapbook pages, and we can try pretty much anything else if you want to make a suggestion!!! We truly are a great group of lively women and would like to get to know more crafters! Please say you'll come! If you are interested, please send me an email so I can put you on the mailing list to let you know of the date/time of our next meeting. Let's get crafty in 2010! Everyone needs a break sometime and creating that something special is an awesome hobby! **I am hosting an Open House on Sunday, March 28th if you want to check it out. Let me know and I will send you the address. Crystal crobin007@yahoo.com <a href="http://crystalwilson.stampinup.net" rel="nofollow">http://crystalwilson.stampinup.net</a> <a href="http://www.facebook.com/pages/Lakeside-CA/Made-with-Love/107193491225" target="_TOP" rel="nofollow">Made with Love</a> <a href="http://www.facebook.com/pages/Lakeside-CA/Made-with-Love/107193491225" target="_TOP" rel="nofollow"><img src="http://badge.facebook.com/badge/107193491225.2574.1883081407.png"></a> <a href="http://www.facebook.com/business/dashboard/" target="_TOP" rel="nofollow">Promote Your Page Too</a> ]]>

<![CDATA[LADIES LADIES LADIES!!! I AM TRYING TO GET SOME LADIES TOGETHER TO HAVE A MARY KAY PARTY IN MY MILITARY HOME!! THIS PARTY WILL INCLUDE HAND CLEANSING, LIP TREATMENT, FACIAL AND MAKE-UP!!! COME LOOKING A HOT MESS AND GO HOME TO YOUR SIGNIFICANT OTHER LOOKING LIKE A DIVA!!! EMAIL FOR DETAILS AND LET ME KNOW THE BEST DAY/TIME FOR YOU!!! THANKS, RACHEAL]]>

<![CDATA[North County San Diego Business Networking Group for Referrals. <a href="http://www.goabra.com" rel="nofollow">http://www.goabra.com</a> <a href="http://www.goabra.com" target="_blank" rel="nofollow"><img src="http://i727.photobucket.com/albums/ww278/abraflyers/CLAd-startingline.jpg"></a>]]>

<![CDATA[San Diego top professional business networking & referral group of ABRA. This is our meeting week, so please visit our website & schedule your free visit today. We meet every OTHER week over a non rigid, yet business minded meeting agenda. Our website allows members to exchange and track their referrals, create strong search engine public profiles and attend free events and business development workshops. What are you waiting for? Secure your position in an ABRA chapter today. we have 10 countywide. <a href="http://www.GOABRA.com" rel="nofollow">http://www.GOABRA.com</a> <a href="http://www.goabra.com" target="_blank" rel="nofollow"><img src="http://i727.photobucket.com/albums/ww278/abraflyers/CLAd-startingline.jpg"></a>]]>

<![CDATA[Nervous about that upcoming interview? Gain public speaking and interviewing skills. Toastmasters can help you lose your fear of public speaking and help you interact with new people. Vapor Trails Toastmasters meets Mondays 6:30-8 pm at the Tierrasanta Recreation Center, located at 11220 Clairemont Mesa Blvd. San Diego, 92124. Visit us at <a href="http://www.vaportrailstm.com/" rel="nofollow">http://www.vaportrailstm.com/</a> ]]>